Other Formats:[FASTA Format][Graphical View]
Links:[1 protein link][20 nucleotide neighbors]
LOCUS       AMHCPPSBA    1187 bp    DNA             PLN       29-DEC-1995
DEFINITION  Amaranthus hybridus chloroplast herbicide binding protein psbA,
            complete cds.
ACCESSION   K01200
NID         g336305
KEYWORDS    herbicide binding protein; herbicide resistance; herbicide
            susceptibility; psbA gene.
SOURCE      Chloroplast Amaranthus hybridus (clone: pAH484 and pAH32S) DNA.
  ORGANISM  Chloroplast Amaranthus hybridus
            Eukaryotae; mitochondrial eukaryotes; Viridiplantae;
            Charophyta/Embryophyta group; Embryophyta; Magnoliophyta;
            Magnoliopsida; Caryophyllales; Amaranthaceae; Amaranthus.
REFERENCE   1  (bases 1 to 1187)
  AUTHORS   Hirschberg,J. and McIntosh,L.
  TITLE     Molecular basis of herbicide resistance in Amaranthus hybridus
  JOURNAL   Science 222, 1346-1349 (1983)
COMMENT     Resistance of this weed and others to s-triazines is maternally
            inherited. This suggests [1] that the trait is coded for by the
            chloroplast genome. The resistance involves a change in the binding
            affinity of triazine to the 32,000-dalton protein coded for by the
            chloroplast gene psbA. The sequence presented here is the
            atrazine-susceptible sequence. There are only three differences
            (all in the coding region--noted in the feature table) in the
            atrazine-resistant mutant, two of which are silent. Thus, it seems
            that a change in one codon (aa 228 - base 814), from serine to
            glycine, changes the binding affinity enough to produce
            atrazine-resistance [1]. Compared in [1] with the psbA genes from
            Spinacia oleracea and Nicotiana debneyi (97.2% and 94.5% homology,
            respectively).
FEATURES             Location/Qualifiers
     source          1..1187
                     /organism="Amaranthus hybridus"
                     /chloroplast
                     /clone="pAH484 and pAH32S"
     gene            133..1086
                     /gene="psbA"
     CDS             133..1086
                     /gene="psbA"
                     /codon_start=1
                     /db_xref="PID:g336306"
                     /translation="MIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISG
                     AIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLG
                     MRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHP
                     FHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGY
                     FGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGFNFNQSVVDSQGR
                     VINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTNG"
     mutation        156
                     /gene="psbA"
                     /note="a in wild type; c in atrazine-resistant mutant"
     mutation        814
                     /gene="psbA"
                     /note="a in wild type; g in atrazine-resistant mutant"
     mutation        882
                     /gene="psbA"
                     /note="t in wild type; c in atrazine-resistant mutant"
BASE COUNT      292 a    232 c    252 g    411 t
ORIGIN      
        1 aattaaataa accaagattt taccatgact gcaattttag agagacgcga aagcgaaagc
       61 ctatggggtc gtttctgtaa ctggataacc agcactgaaa accgtcttta catcggatgg
      121 tttggtgttt tgatgatccc taccttattg actgcaactt ctgtatttat tatagccttc
      181 atagctgctc ctccagtaga tattgatggt attcgtgaac ctgtttctgg atctctactt
      241 tacggaaaca atattatttc gggtgctatt attcctactt ctgcagctat tgggttgcac
      301 ttttacccaa tctgggaagc ggcatcagtt gatgagtggt tatacaatgg tggtccttat
      361 gaactaatcg ttctacactt cttacttggt gtagcttgtt atatgggtcg tgagtgggaa
      421 cttagtttcc gtctgggtat gcgtccgtgg attgctgttg catattcagc tccggttgca
      481 gcggctactg ctgttttctt gatctaccca atcggtcaag gaagcttttc tgatggtatg
      541 cctctaggaa tctctggtac tttcaacttt atgatcgtat tccaggctga gcacaacatc
      601 cttatgcacc catttcacat gttaggtgta gctggtgtat tcggcggctc cctatttagt
      661 gctatgcatg gttccttggt aacttctagt ttgatcaggg aaaccacaga aaatgaatct
      721 gctaacgaag gttacagatt cggtcaagag gaagaaactt ataacatcgt agctgctcat
      781 ggttattttg gtcgattgat cttccaatat gctagtttca acaactctcg ttctttacac
      841 ttcttcttag ctgcttggcc ggtaatcggt atttggttta ctgctttggg tattagtact
      901 atggctttca acctaaacgg tttcaacttc aaccaatctg tagttgatag tcaaggtcgt
      961 gtaattaaca cctgggctga tatcattaac cgtgctaacc ttggtatgga agttatgcat
     1021 gaacgtaatg ctcataactt ccctctagac ttagctgcta tcgaagctcc atctacaaat
     1081 ggataaaatt tcgtttttag tttagtatag atgagttatt gaaagtaaag gagcaatgcc
     1141 gttttcttgt tttgtcaaga aattggttat tgctccatta ttagaac
//



the above report in format.