LOCUS AMHCPPSBA 1187 bp DNA PLN 29-DEC-1995 DEFINITION Amaranthus hybridus chloroplast herbicide binding protein psbA, complete cds. ACCESSION K01200 NID g336305 KEYWORDS herbicide binding protein; herbicide resistance; herbicide susceptibility; psbA gene. SOURCE Chloroplast Amaranthus hybridus (clone: pAH484 and pAH32S) DNA. ORGANISM Chloroplast Amaranthus hybridus Eukaryotae; mitochondrial eukaryotes; Viridiplantae; Charophyta/Embryophyta group; Embryophyta; Magnoliophyta; Magnoliopsida; Caryophyllales; Amaranthaceae; Amaranthus. REFERENCE 1 (bases 1 to 1187) AUTHORS Hirschberg,J. and McIntosh,L. TITLE Molecular basis of herbicide resistance in Amaranthus hybridus JOURNAL Science 222, 1346-1349 (1983) COMMENT Resistance of this weed and others to s-triazines is maternally inherited. This suggests [1] that the trait is coded for by the chloroplast genome. The resistance involves a change in the binding affinity of triazine to the 32,000-dalton protein coded for by the chloroplast gene psbA. The sequence presented here is the atrazine-susceptible sequence. There are only three differences (all in the coding region--noted in the feature table) in the atrazine-resistant mutant, two of which are silent. Thus, it seems that a change in one codon (aa 228 - base 814), from serine to glycine, changes the binding affinity enough to produce atrazine-resistance [1]. Compared in [1] with the psbA genes from Spinacia oleracea and Nicotiana debneyi (97.2% and 94.5% homology, respectively). FEATURES Location/Qualifiers source 1..1187 /organism="Amaranthus hybridus" /chloroplast /clone="pAH484 and pAH32S" gene 133..1086 /gene="psbA" CDS 133..1086 /gene="psbA" /codon_start=1 /db_xref="PID:g336306" /translation="MIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISG AIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLG MRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHP FHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGY FGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGFNFNQSVVDSQGR VINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTNG" mutation 156 /gene="psbA" /note="a in wild type; c in atrazine-resistant mutant" mutation 814 /gene="psbA" /note="a in wild type; g in atrazine-resistant mutant" mutation 882 /gene="psbA" /note="t in wild type; c in atrazine-resistant mutant" BASE COUNT 292 a 232 c 252 g 411 t ORIGIN 1 aattaaataa accaagattt taccatgact gcaattttag agagacgcga aagcgaaagc 61 ctatggggtc gtttctgtaa ctggataacc agcactgaaa accgtcttta catcggatgg 121 tttggtgttt tgatgatccc taccttattg actgcaactt ctgtatttat tatagccttc 181 atagctgctc ctccagtaga tattgatggt attcgtgaac ctgtttctgg atctctactt 241 tacggaaaca atattatttc gggtgctatt attcctactt ctgcagctat tgggttgcac 301 ttttacccaa tctgggaagc ggcatcagtt gatgagtggt tatacaatgg tggtccttat 361 gaactaatcg ttctacactt cttacttggt gtagcttgtt atatgggtcg tgagtgggaa 421 cttagtttcc gtctgggtat gcgtccgtgg attgctgttg catattcagc tccggttgca 481 gcggctactg ctgttttctt gatctaccca atcggtcaag gaagcttttc tgatggtatg 541 cctctaggaa tctctggtac tttcaacttt atgatcgtat tccaggctga gcacaacatc 601 cttatgcacc catttcacat gttaggtgta gctggtgtat tcggcggctc cctatttagt 661 gctatgcatg gttccttggt aacttctagt ttgatcaggg aaaccacaga aaatgaatct 721 gctaacgaag gttacagatt cggtcaagag gaagaaactt ataacatcgt agctgctcat 781 ggttattttg gtcgattgat cttccaatat gctagtttca acaactctcg ttctttacac 841 ttcttcttag ctgcttggcc ggtaatcggt atttggttta ctgctttggg tattagtact 901 atggctttca acctaaacgg tttcaacttc aaccaatctg tagttgatag tcaaggtcgt 961 gtaattaaca cctgggctga tatcattaac cgtgctaacc ttggtatgga agttatgcat 1021 gaacgtaatg ctcataactt ccctctagac ttagctgcta tcgaagctcc atctacaaat 1081 ggataaaatt tcgtttttag tttagtatag atgagttatt gaaagtaaag gagcaatgcc 1141 gttttcttgt tttgtcaaga aattggttat tgctccatta ttagaac //